Bufo bufo (common toad): 121004973 Help Entry 121004973         CDS       T07950                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism bbuf  Bufo bufo (common toad) Pathway bbuf04010   MAPK signaling pathway bbuf04012   ErbB signaling pathway bbuf04068   FoxO signaling pathway bbuf04137   Mitophagy - animal bbuf04140   Autophagy - animal bbuf04150   mTOR signaling pathway bbuf04210   Apoptosis bbuf04218   Cellular senescence bbuf04370   VEGF signaling pathway bbuf04371   Apelin signaling pathway bbuf04540   Gap junction bbuf04625   C-type lectin receptor signaling pathway bbuf04810   Regulation of actin cytoskeleton bbuf04910   Insulin signaling pathway bbuf04912   GnRH signaling pathway bbuf04914   Progesterone-mediated oocyte maturation bbuf04916   Melanogenesis Brite KEGG Orthology (KO) [BR:bbuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121004973 (KRAS)    04012 ErbB signaling pathway     121004973 (KRAS)    04370 VEGF signaling pathway     121004973 (KRAS)    04371 Apelin signaling pathway     121004973 (KRAS)    04068 FoxO signaling pathway     121004973 (KRAS)    04150 mTOR signaling pathway     121004973 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     121004973 (KRAS)    04137 Mitophagy - animal     121004973 (KRAS)   09143 Cell growth and death    04210 Apoptosis     121004973 (KRAS)    04218 Cellular senescence     121004973 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     121004973 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     121004973 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121004973 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     121004973 (KRAS)    04912 GnRH signaling pathway     121004973 (KRAS)    04914 Progesterone-mediated oocyte maturation     121004973 (KRAS)    04916 Melanogenesis     121004973 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbuf04131]     121004973 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bbuf04031]     121004973 (KRAS) Membrane trafficking [BR:bbuf04131]  Endocytosis   Macropinocytosis    Ras GTPases     121004973 (KRAS) GTP-binding proteins [BR:bbuf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     121004973 (KRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  121004973 NCBI-ProteinID:  XP_040293387 LinkDB All DBs Position 1:236303186..236320728 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKMSKEEKTPGC VKIKKCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataaactggtagtggtcggcgctggaggtgtagggaagagcgccctgacg atacaactgatacagaaccattttgttgatgagtatgatcccactatagaggactcctac aggaagcaagtagtaatcgatggagagacgtgcctcttggatattctggacactgcaggt caagaggagtatagtgccatgagagaccagtacatgaggacgggggagggctttctgtgt gtgtttgccattaataatactaaatcgtttgaggacattcatcattatagagagcagata aagagagtgaaggactctgaggacgtaccgatggtcctagtcggcaataaatgtgactta ccttctagaacagtagacaccaaacaagctcaggacctagcgagaagttacggcatacct tttattgagacctctgcaaaaaccagacagagagtggaggatgctttttatacattggtg cgagaaatccgacaatacagattgaaaaagatgagcaaagaagaaaagacgcctggctgt gtgaaaataaaaaaatgccttgtaatgtga

DBGET integrated database retrieval system