Bufo bufo (common toad): 121009570 Help Entry 121009570         CDS       T07950                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism bbuf  Bufo bufo (common toad) Pathway bbuf04081   Hormone signaling bbuf04144   Endocytosis bbuf04150   mTOR signaling pathway bbuf04270   Vascular smooth muscle contraction bbuf04310   Wnt signaling pathway bbuf04350   TGF-beta signaling pathway bbuf04510   Focal adhesion bbuf04520   Adherens junction bbuf04530   Tight junction bbuf04621   NOD-like receptor signaling pathway bbuf04625   C-type lectin receptor signaling pathway bbuf04810   Regulation of actin cytoskeleton bbuf05100   Bacterial invasion of epithelial cells bbuf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     121009570    04350 TGF-beta signaling pathway     121009570    04150 mTOR signaling pathway     121009570   09133 Signaling molecules and interaction    04081 Hormone signaling     121009570  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     121009570   09144 Cellular community - eukaryotes    04510 Focal adhesion     121009570    04520 Adherens junction     121009570    04530 Tight junction     121009570   09142 Cell motility    04810 Regulation of actin cytoskeleton     121009570  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121009570    04625 C-type lectin receptor signaling pathway     121009570   09153 Circulatory system    04270 Vascular smooth muscle contraction     121009570  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     121009570    05100 Bacterial invasion of epithelial cells     121009570  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbuf04131]     121009570   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbuf04147]     121009570    04031 GTP-binding proteins [BR:bbuf04031]     121009570 Membrane trafficking [BR:bbuf04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     121009570 Exosome [BR:bbuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121009570   Exosomal proteins of other body fluids (saliva and urine)    121009570   Exosomal proteins of colorectal cancer cells    121009570   Exosomal proteins of bladder cancer cells    121009570 GTP-binding proteins [BR:bbuf04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     121009570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  121009570 NCBI-ProteinID:  XP_040298720 LinkDB All DBs Position 8:13069667..13076342 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ AKRGRKKTTCNLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatacgtaaaaagcttgtcattgtgggtgatggcgcctgcggtaagacctgt ctgctcatcgtattcagcaaggaccagttcccggaggtctacgtgcccaccgtctttgag aattatgtggctgacatcgaggtcgactccaaacaggtggagctggctctgtgggatacc gctggccaggaggactacgatcgtctcagacccctgtcctatccggatactgatgtcatc ctcatgtgtttctccattgacagccctgacagtttggagaacatccctgagaagtggact ccggaggtgaagcatttctgccccaacgtgcccataatattggtaggaaacaagaaggat ctgaggaatgacgagcacacccggcgtgagctggccaagatgaagcaggagccggtgaag ccagaagaaggcagggatatggcaaataggatcagtgcctttggctacctggaatgctct gctaaaacaaaggacggtgtgcgggaagtgtttgagatggcgacaagagctgccttacaa gccaagagaggtcgcaagaagaccacgtgcaatctcctgtaa

DBGET integrated database retrieval system