Buteo buteo (common buzzard): 142026079 Help Entry 142026079         CDS       T11399                                  Symbol ELOB Name (RefSeq) LOW QUALITY PROTEIN: elongin-B   KO K03873   elongin-B Organism bbut  Buteo buteo (common buzzard) Pathway bbut04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bbut00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     142026079 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bbut04121]     142026079 (ELOB)    03400 DNA repair and recombination proteins [BR:bbut03400]     142026079 (ELOB) Ubiquitin system [BR:bbut04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      142026079 (ELOB)    Cul5 complex      142026079 (ELOB) DNA repair and recombination proteins [BR:bbut03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      142026079 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  142026079 NCBI-ProteinID:  XP_074875005 LinkDB All DBs Position 31:complement(2827216..2832979) Genome browser AA seq 121 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVYDYELKRIVEGILKRPPEEQRLYKDDQLLEDTKTLG DCGFTSQTARPQAPATVGLALRTTEEAFEALRIDPFSSPPELPDVMKPQDSTGGAQEPPL P NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggacgtcttcctgatgatccggcggcacaaaaccaccatcttcaccgacgccaaggag tccagcaccgtctacgactacgagctgaagcgcatcgtggaggggatcctcaagcgcccg cccgaggagcagcgcctctacaaggacgaccagctcctggaggacaccaagaccctcggc gactgcggcttcaccagccagaccgcccgcccccaggcccccgccaccgtggggctggcg ctgcggaccaccgaggaggcgttcgaggcgctgcgcatcgaccccttctccagccccccg gagctgcccgacgtcatgaagccgcaggactcgaccggcggcgcccaggagccgcccctg ccctga

DBGET integrated database retrieval system