Buteo buteo (common buzzard): 142034490 Help Entry 142034490         CDS       T11399                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism bbut  Buteo buteo (common buzzard) Pathway bbut04145   Phagocytosis bbut04814   Motor proteins bbut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbut00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     142034490 (DYNLT1)   09142 Cell motility    04814 Motor proteins     142034490 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     142034490 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bbut03037]     142034490 (DYNLT1)    04812 Cytoskeleton proteins [BR:bbut04812]     142034490 (DYNLT1) Cilium and associated proteins [BR:bbut03037]  Motile cilia and associated proteins   Dynein arm    142034490 (DYNLT1) Cytoskeleton proteins [BR:bbut04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      142034490 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  142034490 NCBI-ProteinID:  XP_074891999 LinkDB All DBs Position 9 Genome browser AA seq 113 aa AA seqDB search MDDFQSGEETSFVVDEVSSIIKEAIESAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacttccagtcaggggaggagacttcctttgttgttgatgaagtcagtagcatc attaaagaggccatagaaagtgcgataggtggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagtgtggtggaacaaacgctaagccaactcacaaagctggggaagcct ttcaagtatattgtgacctgtgtgattatgcaaaagaatggtgctgggctacatacagca agctcttgcttctgggacaactccagtgatggaacctgcactgtgagatgggagaataag actatgtactgtattgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system