Buteo buteo (common buzzard): 142036311 Help Entry 142036311         CDS       T11399                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism bbut  Buteo buteo (common buzzard) Pathway bbut04060   Cytokine-cytokine receptor interaction bbut04218   Cellular senescence bbut04620   Toll-like receptor signaling pathway bbut04621   NOD-like receptor signaling pathway bbut04622   RIG-I-like receptor signaling pathway bbut05132   Salmonella infection bbut05164   Influenza A Brite KEGG Orthology (KO) [BR:bbut00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     142036311  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     142036311  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     142036311    04621 NOD-like receptor signaling pathway     142036311    04622 RIG-I-like receptor signaling pathway     142036311  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     142036311   09171 Infectious disease: bacterial    05132 Salmonella infection     142036311  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbut04052]     142036311    00536 Glycosaminoglycan binding proteins [BR:bbut00536]     142036311 Cytokines and neuropeptides [BR:bbut04052]  Cytokines   Chemokines    142036311 Glycosaminoglycan binding proteins [BR:bbut00536]  Heparan sulfate / Heparin   Chemokines    142036311 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  142036311 NCBI-ProteinID:  XP_074895548 LinkDB All DBs Position 1 Genome browser AA seq 147 aa AA seqDB search MLGTKRYISKMDRPDQASAILRDKRGHCSTGPELNNPAKSSCLIMNSKLVAVLALFLISA AMSQGMTLARMGTELRCQCIATHSKFIPPKSIQDVKLTQSGPHCKNVEVIATLKDGREVC LEPTAPWVQLIVKAILAKAQFNSDSPL NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgctgggcacaaaacggtatataagcaagatggatcgcccagatcaggcatcagcaatc ctccgggacaagagaggtcactgctccacaggaccagagctaaacaatccagcaaaaagc tcctgtctaatcatgaacagcaaacttgtggctgtcctggctcttttcctgatttcagcg gctatgtctcagggtatgaccctggcaaggatgggaaccgagctgcggtgccagtgcata gccacgcattcaaagttcatccctcctaaatccattcaagatgtgaagctgacacagagc ggcccccactgcaagaacgttgaagtcatagctactctgaaggatggcagagaggtgtgc ttggagcccactgctccctgggtacagctgatcgtaaaggcaattttggccaaggctcaa ttcaattctgactcaccactctaa

DBGET integrated database retrieval system