Buteo buteo (common buzzard): 142044822 Help Entry 142044822         CDS       T11399                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism bbut  Buteo buteo (common buzzard) Pathway bbut03082   ATP-dependent chromatin remodeling bbut04217   Necroptosis Brite KEGG Orthology (KO) [BR:bbut00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     142044822  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     142044822  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbut03036]     142044822   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbut04147]     142044822 Chromosome and associated proteins [BR:bbut03036]  Eukaryotic type   Nucleosome assembly factors    Histones     142044822 Exosome [BR:bbut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    142044822 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  142044822 NCBI-ProteinID:  XP_074913837 LinkDB All DBs Position 26:1160082..1160583 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgcgggaagcagggcgggaaggcgcgggccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtgcaccggctgctgcgcaagggcaactac gcggagcgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccggcacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtgaccatcgcgcagggtggggtgctgcccaacatccaggccgtgctgctgcccaagaag accgagagtcacaaggccaagagcaagtga

DBGET integrated database retrieval system