Bdellovibrio bacteriovorus W: BDW_02145
Help
Entry
BDW_02145 CDS
T03036
Name
(GenBank) hypothetical protein
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
bbw
Bdellovibrio bacteriovorus W
Pathway
bbw00770
Pantothenate and CoA biosynthesis
bbw01100
Metabolic pathways
bbw01240
Biosynthesis of cofactors
Module
bbw_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
bbw00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
BDW_02145
Enzymes [BR:
bbw01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
BDW_02145
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
FliS
DUF7102
VirC2
Motif
Other DBs
NCBI-ProteinID:
AHI04939
LinkDB
All DBs
Position
443044..443529
Genome browser
AA seq
161 aa
AA seq
DB search
MSKVAVYPGSFDPITSGHIDIIKRISGLYDKVIVLVAQSSQKQSMFTAQERKVLIENALS
FLPNIEVDIFEGLTVEYMKSRKAQVIIRGLRAVVDFEYEMTMANMNRKIAPEIETLLVFA
SPEFYYVSSRGVKELAINGASLQDLVPDCVEKALQDKLKRG
NT seq
486 nt
NT seq
+upstream
nt +downstream
nt
atgagtaaagtcgctgtttatcctggaagttttgacccgatcacatcggggcatatagat
atcatcaaaagaatttcgggactctatgacaaggtgatcgttttggttgcgcaaagctcc
caaaagcaatccatgttcacagcacaggaacgtaaagttttgattgagaatgctctttcg
tttttgccaaacatcgaagtggatatctttgagggattaacggttgagtatatgaagagc
cgcaaggcccaggtcattattcgtggcttaagagcagtggtcgactttgagtatgaaatg
acgatggcaaatatgaaccgaaagattgcccctgagattgaaacgcttctcgtctttgcg
agccctgagttttactatgtctcttcgcgaggtgtgaaggagcttgcaatcaatggagct
tcattgcaggatcttgtgccagactgtgtagagaaagctctacaagataagttaaaaagg
ggctga
DBGET
integrated database retrieval system