Paraburkholderia caribensis: K788_0000302 Help Entry K788_0000302      CDS       T04141                                  Name (GenBank) DNA-binding protein H-NS   KO K03746   DNA-binding protein H-NS Organism bcai  Paraburkholderia caribensis Brite KEGG Orthology (KO) [BR:bcai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bcai03036]     K788_0000302    03400 DNA repair and recombination proteins [BR:bcai03400]     K788_0000302 Chromosome and associated proteins [BR:bcai03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     K788_0000302 DNA repair and recombination proteins [BR:bcai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       K788_0000302 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  ALL68675 UniProt:  A0A0P0RJG4 LinkDB All DBs Position 2:2636589..2636843 Genome browser AA seq 84 aa AA seqDB search MKEREEHRTLDLDGQARERLVLWIRRRMDEFGITLEALEEALIADAAVPRYRDAFGHEWD GKGDRPDWLTRAINAGQDIEHFRV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaaagagcgagaggaacatcggacgctcgacctcgacggtcaagctcgtgagcggctg gtcttgtggatccgtcgccgcatggatgaatttggcattacgcttgaagcgctcgaagag gcgctaatcgcggacgccgccgtgccgagataccgcgatgcattcgggcacgaatgggac ggcaagggcgaccgccccgactggctgacgcgcgccatcaacgcaggtcaggacatcgag catttccgcgtctga

DBGET integrated database retrieval system