Paraburkholderia caribensis: K788_0001369 Help Entry K788_0001369      CDS       T04141                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism bcai  Paraburkholderia caribensis Brite KEGG Orthology (KO) [BR:bcai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bcai03032]     K788_0001369    03036 Chromosome and associated proteins [BR:bcai03036]     K788_0001369    03400 DNA repair and recombination proteins [BR:bcai03400]     K788_0001369 DNA replication proteins [BR:bcai03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     K788_0001369 Chromosome and associated proteins [BR:bcai03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     K788_0001369 DNA repair and recombination proteins [BR:bcai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       K788_0001369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 DUF2267 Motif Other DBs NCBI-ProteinID:  ALL70287 UniProt:  A0A0P0RN50 LinkDB All DBs Position unnamed:948559..948837 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAASTGESKSSTGEIIDAVITAVTTAVTRGENVQLIGFGSFSTGARAERAG RNPSTGETITIPAAKTVKFTAGKAFKDVVNAI NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcaggaactcatcgacgcagtggccgccagcacgggggagagcaagtccagc actggcgaaatcattgatgccgtcatcacggctgttacgacagccgtcacgcgcggcgag aacgtccagttgatcggctttggttcattctccactggtgcgcgtgctgagcgtgcgggc cgcaacccttctacgggcgagacgattacgatccccgccgccaaaaccgtcaagttcaca gcgggcaaagcgttcaaagacgtggtgaacgccatctga

DBGET integrated database retrieval system