Paraburkholderia caribensis: K788_0004430 Help Entry K788_0004430      CDS       T04141                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism bcai  Paraburkholderia caribensis Brite KEGG Orthology (KO) [BR:bcai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bcai03032]     K788_0004430    03036 Chromosome and associated proteins [BR:bcai03036]     K788_0004430    03400 DNA repair and recombination proteins [BR:bcai03400]     K788_0004430 DNA replication proteins [BR:bcai03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     K788_0004430 Chromosome and associated proteins [BR:bcai03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     K788_0004430 DNA repair and recombination proteins [BR:bcai03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       K788_0004430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 UBA_HYPK HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  ALL65177 UniProt:  A0A0P0RA28 LinkDB All DBs Position 1:2532300..2532572 Genome browser AA seq 90 aa AA seqDB search MNKTELIDHIAQQADISKAAAGRALDAVIGGVKGTLKKGGSVTLVGFGTFAVGKRTARTG RNPRTGAAIKIKAAKVPKFRPGKALKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacggaattgatcgatcacatcgcgcagcaagccgacatttcgaaagcggca gcaggtcgcgcgttggatgccgtgatcggtggcgtcaaaggcacgttgaaaaaaggtggt tcggtcacgctggtcggcttcggcacgttcgccgttggcaagcgcacggcacgcacgggt cgcaatccgcgcacgggcgcagcaatcaagatcaaggcagccaaggttcctaaatttagg cctggcaaagctctgaaggatgcgttaaactaa

DBGET integrated database retrieval system