Bacillus caldolyticus: CWI35_00045 Help Entry CWI35_00045       CDS       T08314                                  Name (GenBank) glutaredoxin family protein   KO K03676   glutaredoxin 3 Organism bcal  Bacillus caldolyticus Brite KEGG Orthology (KO) [BR:bcal00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bcal03110]     CWI35_00045 Chaperones and folding catalysts [BR:bcal03110]  Protein folding catalysts   Protein disulfide isomerase    CWI35_00045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_3 Thioredoxin_2 GST_N Motif Other DBs NCBI-ProteinID:  AUI35114 LinkDB All DBs Position 6285..6530 Genome browser AA seq 81 aa AA seqDB search MAQVTVYTTTTCPYCVMAKNFLRAQGIPFKEVNVELDPEAARRLVETTGQMGVPQIEING RWVLGYDPDAIMALWNQANHR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcacaagtcactgtctatacaacaacgacatgcccgtattgtgtcatggcgaaaaac tttttgcgcgctcaagggattccgtttaaggaagtgaatgtcgagctcgatccggaagcg gcgcggaggctggtggaaacgaccgggcaaatgggcgtgccgcaaatcgagattaacggc cgctgggtgctcgggtatgatccggatgccattatggcattgtggaatcaggcgaatcat cgttga

DBGET integrated database retrieval system