KEGG   Bacillus caldolyticus: CWI35_02470
Entry
CWI35_02470       CDS       T08314                                 
Name
(GenBank) NAD-dependent malic enzyme
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
bcal  Bacillus caldolyticus
Pathway
bcal00620  Pyruvate metabolism
bcal01200  Carbon metabolism
bcal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CWI35_02470
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CWI35_02470
Enzymes [BR:bcal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     CWI35_02470
SSDB
Motif
Pfam: malic Malic_M ThiF ELFV_dehydrog FAD_binding_3 2-Hacid_dh_C Shikimate_DH AlaDh_PNT_C
Other DBs
NCBI-ProteinID: AUI35531
UniProt: A0ABN5FT90
LinkDB
Position
complement(458422..459639)
AA seq 405 aa
MEHLRERALLVHRQARGKLSVEVKVPVVNASDLSLIYSPGVAEPCKEIYVDQDEMYNYTV
KGNFVAVVSNGTAVLGLGNIGARAALPVMEGKAALFKAFAGIDAVPLCLDTEDPEQIIQT
VKLLEPAFGGINLEDIAAPACFVIEERLRQEMAIPVFHDDQHGTAIVVAAGLTNALKVVG
KQLADCRVVINGAGAAGVAIAKLLLSIGVGELIVCDTKGAIYEGRSHGMNAIKEEIARQT
NHRRISGTLADVIQGADVFIGVSVAGALTPAMVRTMNRGAVVFALANPVPEIMPDEAKAA
GAAVVATGRSDLPNQVNNVLAFPGIFRGALDVRATQINEAMKIAAAEAIAGLIQPEELTE
EYVIPNPFDRRVVEAVASAVARAAMETGVARVKEKVEEQNRVREG
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggaacatttgcgagaacgagcgttgcttgtccatcggcaggcaagaggaaagctgtca
gttgaagtgaaagtgccggtcgtgaatgccagtgatttaagtctcatttattcgccggga
gtggctgaaccgtgcaaagaaatttacgtcgaccaagacgaaatgtacaactatacagtg
aagggcaattttgtcgccgtcgtctcgaatggcacggcggtgcttgggcttggcaacatt
ggcgcgcgggcggcgcttccggtcatggaagggaaagccgccttgttcaaagcgttcgcc
gggatcgatgccgtgccgctttgcctcgatactgaagatccggaacaaatcattcaaacg
gtcaagttgctggaaccggcgtttgggggcatcaatttggaagatatcgccgcccccgcc
tgctttgtcattgaagagcgtcttcgccaagagatggcgatcccggtgtttcatgatgat
cagcatggcacggcgattgtcgtggccgctgggctgacgaacgccttgaaagtggttggc
aaacagcttgccgattgccgggttgtcatcaacggcgccggcgctgccggggtggcgatc
gccaaattgctgctgtcgatcggagtcggcgaactgatcgtttgcgacacaaaaggagcg
atttatgaagggcgctcgcatgggatgaacgctatcaaggaagaaatcgcccggcaaacg
aatcaccgccgtatctccgggacgcttgcggacgtcattcaaggcgcggatgtgtttatc
ggtgtctcggttgctggggcgttgacgccggcgatggttcggacgatgaaccgcggggcg
gtcgtattcgccttggccaatccggtgcctgagatcatgccggatgaggcaaaagccgcc
ggcgccgccgtggtcgcgaccggccggtcggatttgccgaaccaagtgaacaacgtgttg
gcgttccctggcattttccgcggcgcgctcgatgtgcgggcgacgcaaattaatgaggcg
atgaaaattgccgctgccgaagccatcgccgggctcatccagccggaagagctgacggaa
gagtatgtcatcccgaacccgtttgaccggcgcgtcgtcgaggccgtcgcttccgccgtc
gcccgtgccgccatggagaccggggtggctcgagtcaaggaaaaagttgaggaacaaaat
cgtgtcagagaggggtag

DBGET integrated database retrieval system