Bacillus caldolyticus: CWI35_02550 Help Entry CWI35_02550       CDS       T08314                                  Name (GenBank) spore coat protein   KO K06440   similar to spore coat protein Organism bcal  Bacillus caldolyticus Brite KEGG Orthology (KO) [BR:bcal00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     CWI35_02550 SSDB OrthologParalogGFIT Motif Pfam:  DUF892 DUF1657 DUF3231 End3 TetR_C_28 DUF2383 Motif Other DBs NCBI-ProteinID:  AUI35541 UniProt:  A0ABM6QJR6 LinkDB All DBs Position 475834..476019 Genome browser AA seq 61 aa AA seqDB search MNAAGTHETLELHELLMFKSTCLAKSAAMQQMASDPQLKSLIQQDMQKTQQHIRDLQNLL S NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgaacgcggcaggaacacacgaaacgcttgagctgcacgaactgcttatgtttaaaagc acctgtcttgccaaaagtgccgccatgcagcaaatggcaagcgatccacaattgaaatcg ctcattcaacaagacatgcaaaagacacagcagcacatccgcgacttgcaaaacttgctg tcataa

DBGET integrated database retrieval system