Bacillus caldolyticus: CWI35_02805 Help Entry CWI35_02805       CDS       T08314                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bcal  Bacillus caldolyticus Pathway bcal01100   Metabolic pathways bcal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CWI35_02805    00074 Mycolic acid biosynthesis     CWI35_02805   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CWI35_02805 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding SHPRH_helical-1st Motif Other DBs NCBI-ProteinID:  AUI35590 LinkDB All DBs Position complement(522334..522573) Genome browser AA seq 79 aa AA seqDB search MGFSDFCQLIAEEAKVPVEQVTAESSFQNDLGVDSLQLVHLLVVLAEKLQLEIGQIPHDL DFRTVGGLYKSLVGKGEII NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggggttttctgacttttgccaattgattgctgaagaggcaaaagtgccggtggagcaa gtaaccgccgaatcttcgtttcaaaatgacttaggggttgattcgttgcaacttgttcat ttgcttgtcgtattggctgaaaagcttcagttagaaattgggcaaattcctcacgatttg gacttccgaaccgttggtggactgtacaagtcgttagttgggaaaggagaaataatatga

DBGET integrated database retrieval system