Brucella canis RM6/66: DK60_580
Help
Entry
DK60_580 CDS
T03270
Symbol
smc
Name
(GenBank) chromosome segregation protein SMC
KO
K03529
chromosome segregation protein
Organism
bcar
Brucella canis RM6/66
Brite
KEGG Orthology (KO) [BR:
bcar00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
bcar03036
]
DK60_580 (smc)
Chromosome and associated proteins [BR:
bcar03036
]
Prokaryotic type
Chromosome partitioning proteins
Condensin-like complex
DK60_580 (smc)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SMC_N
AAA_23
AAA_21
SMC_hinge
AAA_15
ABC_tran
AAA_29
AAA
Motif
Other DBs
NCBI-ProteinID:
AIJ81945
LinkDB
All DBs
Position
1:609403..612861
Genome browser
AA seq
1152 aa
AA seq
DB search
MRFSRLRLVGFKSFVEPMEFVIEGGLTGVVGPNGCGKSNLVEALRWVMGENSYKNMRASG
MDDVIFSGSATRPARNTAEVTLFLDNSDRTAPPAYNDADELQVSRRIEREAGSLYRINGK
EARAKDVQLLFADQSTGARSPSMVGQGRIGELIQAKPQARRALLEEAAGISGLHTRRHEA
ELRLRAAETNLERLDDVVGELGSQIESLKRQARQANRFKSLSADIRRAEAALLHLRWNVA
KGQEAEAQSALSQATATVGDMAEAQMKAARDQAVGAHKLPELREAEAGAAAALQRLSIAR
TQLDEEGERIRARRAELMKRLEQLTADIAREEQMLRENADILARLDEEEQELAASSEASG
ERNEELRALFEEAEIRLQDSESALARLTAERAEAAAERAQVERALKEAQDRRDRLAVQME
NIERDIAAVVGQIGGLFDPAEKRIVVDACTQALEAAEEAVVAAEELVAHAREAEAASRQP
LSEARTELNRIETEAQTLARILNAGETGQFPPVVEELRVEKGYEVALGAALGEDLDAASD
ENAPVYWAYNPAAETDPALPEGAMPLDRLVDGPQQLRRRLAQVGVVSEADGRRLQVGLRP
GQRLVSKTGALWRWDGYTASADAPTPAAQRLAQKNRLAELEQDAIGARRRVVDAGQAVER
AEAAVRKAVEDERVARDQWRANQRKLDEAREALAAAERAAGELATRRSALDESRARLEEN
LEEAQIRVAEAGDRLGEMPDMDAIAQRLSALTSEVQSDRAALAEARAAYEGLRREADARL
RRLEMIALERRNWISRAENADRQIAALNDRRAETAEEAEVLAEAPDEIENRRRALLNELS
LAEERRRAAADILAEAETRQAELDKAATLAIQHLAASREQRARAEERLTAAQERRKDAEA
RIFEALNCPPHEAIRHAGLKPEDAMPDPDQLERQLERLKIERERLGAVNLRAEEESRELS
DRLDALISEREDVIEAIKKLRQAIQSLNREGRERLLAAFDVVNAQFQRLFTHLFGGGTAE
LQLIESDDPLEAGLEILARPPGKKPQTMTLLSGGEQALTAMALIFAVFLTNPAPICVLDE
VDAPLDDHNVERYCNLMDEMAASTETRFVVITHNPITMARMNRLFGVTMGEQGVSQLVSV
DLQTAEQLREAS
NT seq
3459 nt
NT seq
+upstream
nt +downstream
nt
atgcgcttctccaggctgcgccttgtcgggttcaaatccttcgtcgagccgatggagttc
gtcatcgaaggcgggcttacaggcgttgtcggccccaatgggtgcggcaagtccaatctg
gtggaagccctgcgctgggtaatgggtgaaaactcctacaagaacatgcgcgcttccggt
atggacgatgtgattttttccggttccgcgacgcggcccgcgcgcaatacggcggaagtg
acgctttttctcgacaattccgaccgcacggccccacccgcctataacgacgcggatgaa
ttgcaggtgtcgcgccgcatcgagcgtgaggccgggtcgctctaccgcatcaatggcaag
gaagcacgcgccaaggatgtgcagcttttatttgccgatcaatccaccggtgcgcgctcg
ccttccatggtggggcaggggcgtatcggcgagttgatacaggcaaaaccgcaggcgcgc
cgtgcgcttctggaagaggcggcgggcatttccggcctgcacacgcgccgccatgaggcg
gaactgcggctgcgcgcggctgaaaccaatctggagcggctggatgatgtggtgggcgaa
ctgggcagccagattgaaagcctgaaacgccaggcacgccaggccaatcgcttcaaatcg
ctttccgcagatatccgccgcgccgaagcagccttgttgcacctgcgctggaatgtggcc
aaagggcaggaggccgaggcgcagagcgcgctttcgcaggcgaccgcgaccgttggcgat
atggccgaagcgcagatgaaagccgcgcgcgatcaggctgtcggcgcgcataaattgccg
gaattgcgtgaggcggaggccggggctgccgcagccttgcagcgtctttccattgcgcgc
acgcaactggacgaggagggtgagcgcattcgcgcccgccgtgccgaactgatgaagcgg
ctggagcaactgactgcggatatcgcgcgcgaagaacagatgttgcgcgaaaatgccgat
attctggcccggcttgatgaggaggagcaggaactggccgcttccagcgaggcatccggt
gaacgcaatgaggaattgcgcgcgctgttcgaggaagcggaaatccgcttgcaggatagc
gaaagcgcgcttgcccgcttgacggcggagcgggcggaagccgctgccgagcgcgcgcag
gtcgagcgggcgctgaaggaagcgcaggaccggcgtgaccgtctggccgtgcagatggaa
aatatcgagcgcgatatcgcagccgtggttggacagatcggcggtctgttcgatccggcg
gaaaagcgcatcgtggtggatgcctgtacgcaagccctggaagcggccgaagaagcggtt
gtcgcggcggaagaactggtcgcccatgcgcgcgaggcggaagccgcaagccgccagccc
ttgagcgaagcgcgcacggaattgaaccgtatcgaaaccgaggcacagacgctggcgcgc
attctcaatgcgggcgagacaggccaattcccgccggtcgtcgaggaattgcgcgtcgaa
aagggctatgaagtggcgcttggcgcggctttgggcgaagatctcgatgcggcaagcgat
gagaatgcgccggtttactgggcctataatcccgctgccgaaaccgatccggccttgccg
gaaggggccatgccgctcgatcgcctggtggatggcccacagcaattgcgccgcaggctg
gcacaggtgggcgtggtttcggaagcggacggcaggcgtttgcaggtaggcctgagaccg
gggcaaaggcttgtgagcaagacaggcgcgctctggcgctgggacggctatacggcgagc
gccgatgcgcctacgcctgccgcgcagcgtctggcgcagaagaaccggcttgccgaactg
gaacaggatgcaatcggcgcgcgcaggcgcgtggtagatgccgggcaggcggtggaacgc
gcggaagcggcagtgcgcaaggccgttgaggacgagcgcgtggcgcgcgatcaatggcgt
gccaaccagcgcaagctggatgaggcgcgtgaagcactggccgcagccgagcgcgcggca
ggtgagcttgcaacgcgccgctccgcgctggatgaatccagggcgcgtctggaagaaaat
cttgaagaagcgcagatccgtgttgcggaagccggggatcgccttggcgaaatgccggat
atggatgcgattgcccagcgcctttcggcgctgacgagtgaggtgcagtccgaccgcgcg
gcgcttgccgaggcgcgggccgcctatgaaggacttcgccgcgaggccgatgcgcggttg
cgccgccttgaaatgattgcactggaacgccgcaactggatttctcgtgccgaaaatgcc
gatcgccagatcgctgcattgaacgaccgccgggcggaaaccgccgaagaagccgaggtg
ttggcggaagcgcctgacgaaatcgaaaaccgccgccgggcacttttaaacgagctttcg
ctggcggaagagcgtcgcagggcggcggcggatattctggcggaagcggaaacccggcag
gcggaactcgacaaggcggccacgcttgcgatccagcatcttgccgcaagccgcgagcag
cgcgcgcgcgccgaagaacggctgaccgcagcgcaggagcgccgcaaggatgccgaagcg
cgtatttttgaagccttgaactgtccgccgcatgaagcgatccgccatgccggtctgaag
ccggaagacgccatgccggacccggaccagcttgagcgccagttggaacggctgaagatc
gagcgcgagcgtctgggcgcggtgaacctgcgcgcggaggaggagagccgggagctttcg
gaccgtctcgacgcgcttatctccgagcgtgaggatgtgattgaggcgatcaagaagctg
cgtcaggcaatccagagcctgaaccgcgaaggacgcgaacgtttgctggcggcattcgat
gtggtgaatgcgcagttccagcgcctgttcacgcatctgttcggtggcggtacggcggaa
ctgcaactgatcgaaagcgatgatccgctggaagccgggcttgaaattcttgcccgcccg
cccggcaagaagccgcagacgatgacgctgctttccggcggtgagcaggcattgaccgcc
atggcgttgatttttgcggtcttccttaccaatcccgcgccgatctgcgtgctggacgaa
gtggacgcgccgctcgacgaccataatgtcgaacgctattgcaacctgatggacgaaatg
gcggcttcgaccgaaacgcgcttcgtcgtcatcacacataatccgatcaccatggcgcgc
atgaaccgcctgttcggtgtgaccatgggtgagcaaggggtgagccagcttgtctcggtc
gatcttcaaacggcggagcagctacgcgaggcaagttga
DBGET
integrated database retrieval system