Bacillus cereus B4264: BCB4264_A2488 Help Entry BCB4264_A2488     CDS       T00805                                  Name (GenBank) conserved domain protein   KO K06315   transcriptional regulator of the spore photoproduct lyase operon Organism bcb  Bacillus cereus B4264 Brite KEGG Orthology (KO) [BR:bcb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bcb03000]     BCB4264_A2488 Transcription factors [BR:bcb03000]  Prokaryotic type   Other transcription factors    Others     BCB4264_A2488 SSDB OrthologParalogGFIT Motif Pfam:  SplA Motif Other DBs NCBI-ProteinID:  ACK63801 LinkDB All DBs Position 2406088..2406351 Genome browser AA seq 87 aa AA seqDB search MEFSSESNTYHAGDIVYIFYRNPHTQDVANIQAAAVVNNPERPNELALFLYETYYPLTNE MAIYATEDEANQAYTYYYGDISERMLE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaattttcttctgaaagtaatacgtatcatgctggtgacattgtttatattttttac cgaaatcctcatactcaagacgtagctaacatacaagctgcagcagttgtaaataatcct gaaagacctaatgaattagcactatttctttacgaaacgtattatccactaacaaatgag atggctatatatgctaccgaagatgaagcaaaccaagcttacacttactattatggtgat atttcagagaggatgttagaatga

DBGET integrated database retrieval system