Bartonella clarridgeiae: BARCL_0551 Help Entry BARCL_0551        CDS       T01394                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bcd  Bartonella clarridgeiae Pathway bcd01100   Metabolic pathways bcd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BARCL_0551 (acpP)    00074 Mycolic acid biosynthesis     BARCL_0551 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BARCL_0551 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  CBI76232 UniProt:  E6YH94 LinkDB All DBs Position 593304..593540 Genome browser AA seq 78 aa AA seqDB search MSDTEERVRKIIVEHLGVDADKVVENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIFTVGDAVKFIDKASV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagaagagcgcgttagaaagattattgtagagcatcttggagttgacgca gataaggtagtagaaaatgcaagctttatcgatgatctaggagcagatagccttgataca gttgagcttgttatggcttttgaagaagagttcggtatagaaatcccggatgatgctgcc gaaacaatcttcacagttggtgatgcagtgaagtttattgataaagcttctgtataa

DBGET integrated database retrieval system