Burkholderia cepacia DDS 7H-2: DM42_1547 Help Entry DM42_1547         CDS       T03302                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bced  Burkholderia cepacia DDS 7H-2 Brite KEGG Orthology (KO) [BR:bced00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bced03036]     DM42_1547    03400 DNA repair and recombination proteins [BR:bced03400]     DM42_1547 Chromosome and associated proteins [BR:bced03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM42_1547 DNA repair and recombination proteins [BR:bced03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM42_1547 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE YL1_C Motif Other DBs NCBI-ProteinID:  AIO50167 UniProt:  A0A095DN87 LinkDB All DBs Position 1:complement(1683171..1683464) Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLAELGLSRAKAGKVGRP RAGVAAKYRDPETGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctggcccagcgggagaagctggagaagcaaatcgaagaa gcgaagtcgcgtgaatacgctgaagtgctgaatgacgtgaagcagaaaattgccgactac ggcttttcgctcgccgaactcggtctcagccgcgcgaaggccggcaaggtcggtcgtccg cgcgcaggcgtggcggcaaaataccgcgatccggaaacgggcgcgacgtggtcgggccgt ggcaagccgccgcgctggatcgccggcaagaaccgcgaacagtttgcgatttaa

DBGET integrated database retrieval system