Burkholderia cepacia DDS 7H-2: DM42_2214 Help Entry DM42_2214         CDS       T03302                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism bced  Burkholderia cepacia DDS 7H-2 Brite KEGG Orthology (KO) [BR:bced00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bced03110]     DM42_2214 (grxC) Chaperones and folding catalysts [BR:bced03110]  Protein folding catalysts   Protein disulfide isomerase    DM42_2214 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 DSBA Motif Other DBs NCBI-ProteinID:  AIO49447 UniProt:  A0AA89CJ52 LinkDB All DBs Position 1:2394528..2394788 Genome browser AA seq 86 aa AA seqDB search MNKVLMYSTQVCPYCMQAERLLKLRGVEQIEKVLIDRDPARREEMMTRTGRRTVPQIYIG DTHVGGYDDLSKLDREGGLVPLLQAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaggttttgatgtacagcacgcaggtgtgtccgtattgcatgcaggccgagcgc ctgctgaagctgcgcggcgtcgagcagatcgaaaaggtgctgatcgatcgcgatccggcc cgccgcgaggaaatgatgacgcgcacggggcgccgcacggtgccgcagatctatatcggc gacacgcacgtcggcggctacgacgatctgtcgaagctcgaccgcgaaggcggcctcgtg ccgcttctgcaagcggcctga

DBGET integrated database retrieval system