Burkholderia cepacia DDS 7H-2: DM42_2250 Help Entry DM42_2250         CDS       T03302                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bced  Burkholderia cepacia DDS 7H-2 Pathway bced00190   Oxidative phosphorylation bced01100   Metabolic pathways bced02020   Two-component system Module bced_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bced00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DM42_2250  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DM42_2250 Enzymes [BR:bced01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      DM42_2250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AIO49496 UniProt:  A0AA88Z816 LinkDB All DBs Position 1:complement(2433484..2433606) Genome browser AA seq 40 aa AA seqDB search MWYFSWILGIGVALSFGIVNAMWLEARQKPQEAPVRARRD NT seq 123 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcagctggattctcggtatcggcgtcgcgctgtcgttcggcatcgtcaac gcgatgtggctcgaagcgcggcagaagccgcaggaagcgccggtgcgtgcgcgccgcgac tga

DBGET integrated database retrieval system