KEGG   Brucella ceti TE28753-12: V568_100654
Entry
V568_100654       CDS       T02935                                 
Name
(GenBank) UvrD/REP helicase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
bcee  Brucella ceti TE28753-12
Pathway
bcee03420  Nucleotide excision repair
bcee03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bcee00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    V568_100654
   03430 Mismatch repair
    V568_100654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcee03400]
    V568_100654
Enzymes [BR:bcee01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     V568_100654
DNA repair and recombination proteins [BR:bcee03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     V568_100654
   MMR (mismatch excision repair)
    Other MMR factors
     V568_100654
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 PcrA_UvrD_tudor Viral_helicase1 AAA_11 DUF4420
Other DBs
NCBI-ProteinID: AHB01732
LinkDB
Position
1:complement(617551..620127)
AA seq 858 aa
MSDFPDDMPFFGDDDAPAGRAPAPGSIAARAMAARNQQHGEPDYLKGLNPEQKQAVLTTE
GPVLVLAGAGTGKTRVLTTRIAHILSTGLAYPSQILAVTFTNKAAREMKERIGHLVGGAV
EGMPWLGTFHSIGVKLLRRHAELVNLTSSFTILDTDDVIRLIKQLIQAEGLDDKRWPART
FANMIDGWKNKGFSPADIPEGDARSFGNGRGRELYQAYQERLRTLNACDFGDLLLHPIRI
FRNHPDILREYHAKFRYILVDEYQDTNTAQYLWLRLLAQRPKSRTTAPTQAGGSPVQPAR
ASEGPCGAGERSELGVSEDKVNLCCVGDDDQSIYGWRGAEVDNILRFEKDFPGAVVIKLE
RNYRSTAHILGTAAHLIAHNEGRLGKTLFTEAPNPDDPRVKVHAAWDSEEEARAVGEAIE
QAQRQGHLLNNMAILVRASFQMREFEDRFVTLGLNYRVIGGPRFYERLEIRDAMAYLRVV
AQPADDLALERIINTPKRGLGEAAIRQIHDYARARDISMFAAACDLIETEELKPKPRSAL
REVVENFLRWQSLIDTTPHTELAETILDESGYTAMWQNDKSAEAPGRLENLKELIRSMEE
YESLRGFLEHVALVMDAEQNEDMDAVNIMTLHSAKGLEFETVFLPGWEEGLFPHQRALDE
GGRSGLEEERRLAYVGVTRAKKNLHIWFVSNRRIHGMWQSTIPSRFLEELPEAHVEVAEL
EGNYGGYGGGYGQSRFDKADPFQNSYSTPGWQRAQQNRSDATRNNWGSRSGSRVERIGYG
ETDSGFGAGRGSVKGRTIEGELVAKSVADKPSAFKLGDRVFHIKFGNGTISLIDGNKLTI
NFDKAGQKRVLDSFVQPI
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgtccgattttcccgacgatatgccgtttttcggcgatgacgacgctccggctggccgc
gcgcccgctcccggcagcattgccgcacgcgccatggccgcacgcaaccagcagcatggc
gagcccgattacctcaagggcctgaacccggagcagaaacaggcggtgctcaccaccgag
ggcccggttctggtgctggcgggtgctggcaccggcaagacgcgcgtgctcaccacgcgc
attgcacatattctttcgaccggccttgcctatccgagccagattttggccgtgaccttc
accaacaaggccgcgcgcgaaatgaaggagcgtatcggccatctggtcggcggtgctgtt
gaaggcatgccctggcttggcacattccactccatcggcgtcaagcttttgcgccgccac
gccgaactggtcaatcttacctccagcttcaccatcctcgatacggacgatgtgatccgg
ctcatcaagcagcttattcaggccgaaggactggatgacaaacgctggcctgcccgcacc
ttcgccaatatgatcgacggctggaagaataagggtttcagtcccgccgatattcccgaa
ggggatgcgcgctcgttcggcaacgggcggggccgtgagctttatcaggcctatcaggaa
cggttgcgcacactgaacgcctgtgattttggcgatcttctgctgcatccgatccgcatc
ttccgcaaccacccggatatcctgcgcgaatatcatgcaaaattccgctacattctggtg
gacgaatatcaggacaccaacaccgcacaatatctctggctgcgtctgctagcacagcga
ccaaaatcacgaacgacagcgccaacgcaggccggaggctcgccagtacagcccgctagg
gcgtccgaaggcccctgcggagccggtgagcgcagcgaactcggcgtgagcgaagacaaa
gtaaacttgtgttgtgtgggcgatgacgaccagtcgatctatggctggcgcggagcggaa
gtggacaatatcttgcgctttgagaaggactttccgggcgcggtcgttatcaagcttgag
cgcaattatcgctccacggcgcatattctgggcactgccgcgcatctgatcgcgcataat
gaaggccgtttgggcaagacgcttttcaccgaggcacccaatccggatgacccgcgcgtc
aaggtccatgcggcctgggactcggaagaggaagcgcgtgcggttggcgaagccatcgag
caggcgcagcgtcaggggcaccttctcaacaatatggcgatccttgtgcgcgcctccttc
cagatgcgtgagtttgaagaccgttttgtcacgctcggcctcaattatcgcgtcataggc
ggcccgcgcttctatgagcgcctcgaaattcgcgatgccatggcatatctgcgcgtcgtc
gcgcaacccgccgacgatctggcgctggagcgcatcatcaacacgccaaagcgcggcctt
ggcgaagcagccatccgccagattcatgactatgcgcgcgcgcgcgacatttccatgttc
gctgcggcctgcgacctcatagaaaccgaggagctgaaacccaagccacgctctgccctg
cgtgaggtggtggagaatttcctgcgctggcagtcgctgatcgacaccacgccgcatacg
gaactggcggaaaccattcttgatgaatccggctacaccgccatgtggcagaacgacaaa
tcagcggaagcgccgggccggcttgaaaacctcaaggaactgatccgttccatggaggaa
tatgaaagcctgcgtggtttcctcgaacatgtcgcgctcgtcatggatgccgagcagaat
gaggatatggatgccgtcaacatcatgacgctgcattcggccaaggggctggagtttgaa
accgtcttccttcccggctgggaggaaggcctgtttccacaccagcgcgcgcttgatgaa
ggcggacgttcggggctggaggaagagcgccgcctcgcctatgtcggcgtcacccgcgcc
aagaaaaacctgcatatctggttcgtgtccaaccgccgcatccacggcatgtggcaatcg
accatcccgtcgcgctttctggaagagcttcccgaagcacatgtggaggtggccgaactg
gaaggtaattatggtggttatggcggcggctatggacagtcccgtttcgacaaggccgac
cccttccagaactcctattccacacccggctggcagcgtgcgcagcagaaccgttcggat
gcaacgcgcaacaactggggttcgcgctcgggcagccgcgtggagcgcattggctatggc
gagaccgattccggcttcggtgcggggcgtggatcggtaaaaggccgcacgattgaaggc
gaactggtggcaaaatcagtggccgacaaaccatcggccttcaagcttggcgaccgcgta
ttccatatcaaattcggaaacggcacgatttcgcttatcgacggcaacaagctgacgatc
aatttcgacaaggccggacaaaagcgcgttctcgatagtttcgtccagccgatctaa

DBGET integrated database retrieval system