Bacteroides cellulosilyticus: BcellWH2_00538 Help Entry BcellWH2_00538    CDS       T04116                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism bcel  Bacteroides cellulosilyticus Pathway bcel01100   Metabolic pathways bcel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BcellWH2_00538    00074 Mycolic acid biosynthesis     BcellWH2_00538   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BcellWH2_00538 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding IRK_C DUF3046 Motif Other DBs NCBI-ProteinID:  ALJ57806 UniProt:  A0A0P0FTZ7 LinkDB All DBs Position complement(529271..529507) Genome browser AA seq 78 aa AA seqDB search MEIKEFIENFADQFDETDASVLTPETVFHELEDYSSLVALSIIAMIDEEYGVTLKGSDMS AAITIQDLFNTIQAKSEE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaatcaaagaattcattgagaattttgctgatcagttcgatgaaactgatgcaagt gtactcactcctgagacagtgttccacgagttagaagattattcatcacttgtagcctta tctattatagccatgatagatgaggaatatggtgtaacattaaaaggtagcgatatgagt gcggctatcactattcaggatttgttcaatacgattcaagcaaagtcggaagaatga

DBGET integrated database retrieval system