Bacteroides cellulosilyticus: BcellWH2_02476 Help Entry BcellWH2_02476    CDS       T04116                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bcel  Bacteroides cellulosilyticus Pathway bcel01100   Metabolic pathways bcel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BcellWH2_02476 (acpP_1)    00074 Mycolic acid biosynthesis     BcellWH2_02476 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BcellWH2_02476 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ALJ59715 UniProt:  A0A0N7IFB2 LinkDB All DBs Position 3040057..3040293 Genome browser AA seq 78 aa AA seqDB search MSEIASRVKAIIVDKLGVEESEVTNEASFTNDLGADSLDTVELIMEFEKEFGISIPDDQA EKIGTVGDAVSYIEEHAK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaattgcatcaagagtgaaagcgattatcgtcgacaaattaggcgttgaagaa tcagaagttactaacgaagctagcttcactaacgatttaggagctgattctcttgacact gtagaacttatcatggaattcgaaaaggaattcggtatctctattccggatgaccaagct gaaaagattggtactgtaggcgacgccgtttcttacatcgaagaacacgctaagtaa

DBGET integrated database retrieval system