Bacteroides cellulosilyticus: BcellWH2_03916 Help Entry BcellWH2_03916    CDS       T04116                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bcel  Bacteroides cellulosilyticus Pathway bcel01100   Metabolic pathways bcel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BcellWH2_03916 (acpP_2)    00074 Mycolic acid biosynthesis     BcellWH2_03916 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BcellWH2_03916 (acpP_2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF4438_C Motif Other DBs NCBI-ProteinID:  ALJ61137 UniProt:  A0A0P0GSV9 LinkDB All DBs Position complement(5064039..5064296) Genome browser AA seq 85 aa AA seqDB search MTHEEIIEKIRETLSEEFEVDIDLIQPDAPLMQTLELDSLDLVDMVVLIEKNFGFNVTGQ DFVGIKTFQDFYNLVITRMAENKNE NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacccacgaagaaatcattgaaaagataagagaaaccttatccgaggaatttgaagta gatatcgatcttatccagcctgatgctccgctcatgcaaacccttgagttagacagtctg gacttggtagatatggtagtgttgattgaaaagaacttcggttttaatgtaaccggacaa gattttgtcggaatcaaaacgttccaggacttctataatctcgtcatcacacgtatggcc gaaaacaaaaacgaataa

DBGET integrated database retrieval system