Burkholderia cenocepacia DDS 22E-1: DM39_1688 Help Entry DM39_1688         CDS       T03308                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bcen  Burkholderia cenocepacia DDS 22E-1 Pathway bcen00190   Oxidative phosphorylation bcen01100   Metabolic pathways bcen02020   Two-component system Module bcen_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bcen00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DM39_1688  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DM39_1688 Enzymes [BR:bcen01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      DM39_1688 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB B277 Motif Other DBs NCBI-ProteinID:  AIO31800 UniProt:  A0AAN0RPY3 LinkDB All DBs Position 1:1840230..1840376 Genome browser AA seq 48 aa AA seqDB search MWYFAWILGIGVALGFGIINAMWLEAEVFSRDGKRVDTPRQGPGSRYS NT seq 147 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcgtggatactcggcatcggcgtggcgctcggcttcggcatcatcaat gcaatgtggctcgaagccgaagtgttctctcgcgacggcaagcgcgtcgacacgccgcgt caggggccggggagccgctattcgtga

DBGET integrated database retrieval system