Burkholderia cenocepacia DDS 22E-1: DM39_4168 Help Entry DM39_4168         CDS       T03308                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bcen  Burkholderia cenocepacia DDS 22E-1 Brite KEGG Orthology (KO) [BR:bcen00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bcen03036]     DM39_4168    03400 DNA repair and recombination proteins [BR:bcen03400]     DM39_4168 Chromosome and associated proteins [BR:bcen03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM39_4168 DNA repair and recombination proteins [BR:bcen03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM39_4168 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS SpoIISB_antitox Motif Other DBs NCBI-ProteinID:  AIO36797 UniProt:  A0AAN0RZ72 LinkDB All DBs Position 2:930451..930753 Genome browser AA seq 100 aa AA seqDB search MATYLELKSQAETLLQEAEAARLAELQTVLDEVRARVAEYGLTPEQVFGRRKIARKSSGK KSTTSVAKYQDPKTGATWSGRGREPSWIKGKKRERFLIAT NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcaacttatctcgaattgaaatctcaagctgaaacgcttctgcaggaggccgaagca gcgcgtcttgcagagctccagaccgtccttgatgaggtccgtgcacgtgttgcggaatac ggattgactccagagcaagtatttggccgccgcaaaatcgcgaggaagagctcgggtaag aaatccaccacttcagttgccaaataccaagatccgaaaaccggtgcgacgtggagcggc cgcggacgcgaaccctcgtggatcaagggcaagaagcgcgagcgcttcctgatcgccacc tga

DBGET integrated database retrieval system