Burkholderia cenocepacia DDS 22E-1: DM39_962 Help Entry DM39_962          CDS       T03308                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bcen  Burkholderia cenocepacia DDS 22E-1 Pathway bcen00998   Biosynthesis of various antibiotics bcen01100   Metabolic pathways bcen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcen00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM39_962 (acpP)    00074 Mycolic acid biosynthesis     DM39_962 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM39_962 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AIO33001 UniProt:  A0A071MVE8 LinkDB All DBs Position 1:1027757..1027996 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgccgaacaactgggcgtcgcggaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgccgactcgctcgacacc gtcgaactggtgatggctctcgaagacgagttcggcatggaaattccggacgaggaagcg gagaagatcacgacggttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system