Burkholderia cenocepacia H111: I35_0161 Help Entry I35_0161          CDS       T03804                                  Name (GenBank) DNA-binding protein H-NS   KO K03746   DNA-binding protein H-NS Organism bceo  Burkholderia cenocepacia H111 Brite KEGG Orthology (KO) [BR:bceo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bceo03036]     I35_0161    03400 DNA repair and recombination proteins [BR:bceo03400]     I35_0161 Chromosome and associated proteins [BR:bceo03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     I35_0161 DNA repair and recombination proteins [BR:bceo03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       I35_0161 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE YL1_C Motif Other DBs NCBI-ProteinID:  CDN58684 LinkDB All DBs Position 1:181065..181358 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLAELGLSRAKAGKVGRP RAGVAAKYRDPETGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctggcccagcgggagaagctggagaagcaaatcgaagaa gcgaagtcgcgtgaatacgctgaagtgctgaatgacgtgaagcagaaaattgccgactac ggcttttcgctcgccgaactcggtctcagccgcgcgaaggccggcaaggtcggtcgtccg cgcgcaggcgtggcggcaaaataccgcgatccggaaacgggcgcgacgtggtcgggccgt ggcaagccgccgcgctggatcgccggcaagaaccgcgaacagtttgcgatttaa

DBGET integrated database retrieval system