Burkholderia cenocepacia H111: I35_0992 Help Entry I35_0992          CDS       T03804                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bceo  Burkholderia cenocepacia H111 Pathway bceo00998   Biosynthesis of various antibiotics bceo01100   Metabolic pathways bceo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bceo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I35_0992 (acpP)    00074 Mycolic acid biosynthesis     I35_0992 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I35_0992 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  CDN59515 LinkDB All DBs Position 1:1056210..1056449 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgctgaacaactgggcgtcgcggaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgcggactcgctcgacacg gtcgaactggtgatggctctcgaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system