Burkholderia cepacia ATCC 25416: APZ15_04270 Help Entry APZ15_04270       CDS       T04772                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bcep  Burkholderia cepacia ATCC 25416 Brite KEGG Orthology (KO) [BR:bcep00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bcep03032]     APZ15_04270    03036 Chromosome and associated proteins [BR:bcep03036]     APZ15_04270    03400 DNA repair and recombination proteins [BR:bcep03400]     APZ15_04270 DNA replication proteins [BR:bcep03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     APZ15_04270 Chromosome and associated proteins [BR:bcep03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     APZ15_04270 DNA repair and recombination proteins [BR:bcep03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       APZ15_04270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  ALK17085 LinkDB All DBs Position 1:complement(941279..941557) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccgcccaaacgggcgccagcaaggctcaa accggcgaaacgctggacacgctgctcgaagtcatcaagaaggccgtgtcgaagggtgat gcggttcagctgatcggcttcggcagcttcggttcgggcaagcgcgcagcacgtacgggc cgcaacccgaagacgggcgaaaccatcaagatcccggcagccaagacggtcaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagcgttaa

DBGET integrated database retrieval system