Burkholderia cepacia ATCC 25416: APZ15_37555 Help Entry APZ15_37555       CDS       T04772                                  Name (GenBank) histone   KO K03746   DNA-binding protein H-NS Organism bcep  Burkholderia cepacia ATCC 25416 Brite KEGG Orthology (KO) [BR:bcep00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bcep03036]     APZ15_37555    03400 DNA repair and recombination proteins [BR:bcep03400]     APZ15_37555 Chromosome and associated proteins [BR:bcep03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     APZ15_37555 DNA repair and recombination proteins [BR:bcep03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       APZ15_37555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS AT_hook Motif Other DBs NCBI-ProteinID:  ALK23785 LinkDB All DBs Position pBC25416:3400..3699 Genome browser AA seq 99 aa AA seqDB search MSTFQELLARRAALETEIQTAKAGERSNALKEVKRLVDEFDFSTREIFGTSKIRKRQTVQ PRYRDPATGATWSGRGRPPKWIDGKDRSQYRIEAPATHA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccttccaagaactgctcgcacggcgagctgcccttgaaacggaaattcagacc gccaaggcaggagagcgctcgaatgcgctgaaggaagtcaaacgactcgtggacgagttc gacttctcgacgcgggagattttcggcacgagcaagattcggaagcgccagaccgttcag cctcggtatcgcgatcccgcgactggcgcgacgtggagcggtcgcggccggccgccgaag tggattgacggcaaggaccgctcgcagtaccggatcgaggcgccggccacgcacgcttga

DBGET integrated database retrieval system