Bacillus cereus FRI-35: BCK_16000 Help Entry BCK_16000         CDS       T02291                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bcer  Bacillus cereus FRI-35 Pathway bcer01100   Metabolic pathways bcer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcer00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BCK_16000 (acpP)    00074 Mycolic acid biosynthesis     BCK_16000 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BCK_16000 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  AFQ11098 LinkDB All DBs Position 3132867..3133100 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISDEDA EKIATVGDAVTYIESHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttttagagcgtgtaacaaaaattatcgttgatcgtttaggagtagaagaa acagaagtagtaccagctgcaagcttcaaggaagatttaggagcagactccctagatgta gtagaacttgtaatgcaattagaagacgaattcgaaatggaaatttctgatgaagatgct gaaaagattgctactgttggcgatgctgtgacttacatagagagtcatctataa

DBGET integrated database retrieval system