Brucella ceti TE10759-12: V910_101501 Help Entry V910_101501       CDS       T02934                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bcet  Brucella ceti TE10759-12 Pathway bcet01100   Metabolic pathways bcet01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcet00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     V910_101501    00074 Mycolic acid biosynthesis     V910_101501   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     V910_101501 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AHA99905 LinkDB All DBs Position 1:complement(1527661..1527897) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system