Burkholderia cenocepacia DWS 37E-2: DM40_1136 Help Entry DM40_1136         CDS       T03488                                  Name (GenBank) STAS domain protein   KO K07122   phospholipid transport system transporter-binding protein Organism bcew  Burkholderia cenocepacia DWS 37E-2 Pathway bcew02010   ABC transporters Brite KEGG Orthology (KO) [BR:bcew00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     DM40_1136  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bcew02000]     DM40_1136 Transporters [BR:bcew02000]  ABC transporters, prokaryotic type   Saccharide, polyol, and lipid transporters    Phospholipid transporter     DM40_1136 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  STAS_2 STAS Motif Other DBs NCBI-ProteinID:  AIO40370 UniProt:  A0AA86FIR6 LinkDB All DBs Position 1:1234297..1234572 Genome browser AA seq 91 aa AA seqDB search MSGFAAGSSLTVASAKAALADGLARIDAGATAVDFAALTQFDSSALAVLLAWQRAAHARG ATLDILNLPPKLASLARAYGVDTLVEPTGRH NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgagcggcttcgcagccggctcgtcgctgaccgtcgcgagcgcgaaggccgcgctcgcg gacggtcttgcgcgcatcgatgcgggcgccaccgccgtcgattttgccgcgctcacgcag ttcgactcgtccgcgcttgccgtgctgctcgcctggcaacgcgccgcccacgcgcgcggc gccaccctcgacatcctcaatctccctccgaagctcgcgagcctcgctcgcgcgtacggc gtcgacaccctcgtcgaacccaccggccgacattga

DBGET integrated database retrieval system