Burkholderia cenocepacia DWS 37E-2: DM40_1786 Help Entry DM40_1786         CDS       T03488                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bcew  Burkholderia cenocepacia DWS 37E-2 Pathway bcew00998   Biosynthesis of various antibiotics bcew01100   Metabolic pathways bcew01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcew00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM40_1786 (acpP)    00074 Mycolic acid biosynthesis     DM40_1786 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM40_1786 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AIO41771 UniProt:  A0A071MVE8 LinkDB All DBs Position 1:1916013..1916252 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgccgactcgctcgacacc gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgacggttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system