Burkholderia cenocepacia DWS 37E-2: DM40_2405 Help Entry DM40_2405         CDS       T03488                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bcew  Burkholderia cenocepacia DWS 37E-2 Pathway bcew02024   Quorum sensing bcew03018   RNA degradation Brite KEGG Orthology (KO) [BR:bcew00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DM40_2405 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DM40_2405 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bcew03019]     DM40_2405 (hfq)    03036 Chromosome and associated proteins [BR:bcew03036]     DM40_2405 (hfq) Messenger RNA biogenesis [BR:bcew03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DM40_2405 (hfq) Chromosome and associated proteins [BR:bcew03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DM40_2405 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AIO40692 UniProt:  A0A071MNF0 LinkDB All DBs Position 1:complement(2608695..2608934) Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFHPDAEASS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgttacaagacccgtttttgaacgcactgcgcaaagagcac gttcccgtttcgatctatctcgtcaacggcatcaagctgcaagggaacattgaatcgttc gaccagtacgtcgtgttgctccgtaatacggtgacccagatggtttacaagcacgccatc tcgacggtcgtgccggcgcgcccggtgaatttccacccggacgcggaagcctcgtcctaa

DBGET integrated database retrieval system