Bacillus cereus G9842: BCG9842_B3490 Help Entry BCG9842_B3490     CDS       T00815                                  Name (GenBank) conserved domain protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism bcg  Bacillus cereus G9842 Pathway bcg00290   Valine, leucine and isoleucine biosynthesis bcg00650   Butanoate metabolism bcg00660   C5-Branched dibasic acid metabolism bcg00770   Pantothenate and CoA biosynthesis bcg01100   Metabolic pathways bcg01110   Biosynthesis of secondary metabolites bcg01210   2-Oxocarboxylic acid metabolism bcg01230   Biosynthesis of amino acids Module bcg_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine bcg_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:bcg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BCG9842_B3490    00660 C5-Branched dibasic acid metabolism     BCG9842_B3490   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BCG9842_B3490   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BCG9842_B3490 Enzymes [BR:bcg01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BCG9842_B3490 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT ACT_4 Motif Other DBs NCBI-ProteinID:  ACK95500 UniProt:  B7IRE2 LinkDB All DBs Position 1712824..1713054 Genome browser AA seq 76 aa AA seqDB search MSHTFSLVIHNEPSVLLRISGIFARRGYYISSLHLNERDTSGVSEMKLTAVCTENEATLL VSQLKKLIDVLQVNKL NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtcatactttttcactcgttattcataacgagccaagcgtcttattacgtataagt gggatttttgctcggcgtggttattatatttcttctttacatttaaatgaaagagataca agtggtgtttctgaaatgaaactcacagcagtttgtactgaaaatgaagcgacattactt gttagtcagttgaaaaaattaattgatgtactgcaagtaaataaattataa

DBGET integrated database retrieval system