Burkholderia cenocepacia HI2424: Bcen2424_1124 Help Entry Bcen2424_1124     CDS       T00415                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bch  Burkholderia cenocepacia HI2424 Pathway bch00998   Biosynthesis of various antibiotics bch01100   Metabolic pathways bch01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bch00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bcen2424_1124    00074 Mycolic acid biosynthesis     Bcen2424_1124   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bcen2424_1124 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ABK07876 UniProt:  A0K5U9 LinkDB All DBs Position 1:1235253..1235492 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgctgagcaactgggcgtcgcggaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgccgattcgctcgacacg gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system