Burkholderia cenocepacia HI2424: Bcen2424_2819 Help Entry Bcen2424_2819     CDS       T00415                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bch  Burkholderia cenocepacia HI2424 Pathway bch00190   Oxidative phosphorylation bch01100   Metabolic pathways bch02020   Two-component system Module bch_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bch00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Bcen2424_2819  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Bcen2424_2819 Enzymes [BR:bch01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Bcen2424_2819 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABK09569 LinkDB All DBs Position 1:3115356..3115478 Genome browser AA seq 40 aa AA seqDB search MWYFSWILGIGVALSFGIVNAMWLEARQKTQEAPVRARRD NT seq 123 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcagctggattctcggtatcggcgtcgcgctgtcgttcggcatcgtcaac gcgatgtggctcgaagcgcggcagaagacgcaggaagcgcccgtgcgtgcgcggcgcgac tga

DBGET integrated database retrieval system