Evansella cellulosilytica: Bcell_2534 Help Entry Bcell_2534        CDS       T01389                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bco  Evansella cellulosilytica Pathway bco01100   Metabolic pathways bco01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bco00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bcell_2534    00074 Mycolic acid biosynthesis     Bcell_2534   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bcell_2534 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  ADU30791 UniProt:  E6TTM2 LinkDB All DBs Position complement(2737902..2738135) Genome browser AA seq 77 aa AA seqDB search MAAVIDRIAKIVSDRLGVDESEIKPEATFKEDLGADSLDVVELVMELEDEFDLEISDEDA EKISTVGDVIDYIERQQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtaatagatcgtattgcaaaaattgtatcagacagactgggtgtagatgaa tcagaaattaaacctgaagctacttttaaagaagatttaggtgcagactccttggatgta gttgaactagtaatggaacttgaagatgagttcgacttagaaatttccgatgaagatgct gagaaaatttcaactgtaggtgacgttattgattacatagagcgtcaacaatag

DBGET integrated database retrieval system