KEGG   Bacillus cellulosilyticus: Bcell_2925
Entry
Bcell_2925        CDS       T01389                                 
Name
(GenBank) basic membrane lipoprotein
  KO
K05519  transcriptional activator of comK gene
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bco03000]
    Bcell_2925
Transcription factors [BR:bco03000]
 Prokaryotic type
  Other transcription factors
   Others
    Bcell_2925
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: ADU31176
UniProt: E6TXW3
LinkDB
Position
complement(3116461..3117426)
AA seq 321 aa
MKGYIYLLIVLSILLFTGCSQSDETHVEFKKIGLLLSDPIDDHGWNSKAYQGVLNIQSTF
DVQVYIKEDIQTSEQIYESIEEFSNEGVTLLFGHSYLYADYFMDLKDEYPHIHFVSFNGD
VSGDGITSIHFEGYSMGYFAGMLASEMSHSNKVGIIAAFPFQPEVEGFIEGANYQNENIK
VFTEFVYDWTNEEKALEHFYNMKGLEVDIFYPAGDGFHVTLVNEIKDSGLYAIGYVGDHI
DLGESTILTSTVQDVERLYEHVANEYQNGTLENGNIYYDFEEGVISLGTFSTEVPDEIRE
KIEVAIAHYIETGQLPHEMNE
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaagggctatatttatttattgatagtattaagcatcttactatttacaggctgctca
caaagtgatgaaacacatgtagaatttaagaaaataggattgttattatctgatccaatt
gatgatcacggttggaatagtaaggcttatcaaggagtacttaatattcagtctacattt
gatgttcaagtatacataaaggaagatattcaaacatccgaacaaatatatgaatctata
gaggaatttagtaacgaaggagtcacacttctttttggacatagctatttatatgcagac
tattttatggatttaaaagatgagtatccccatattcattttgtaagctttaatggagat
gtttctggagatgggataacaagtattcattttgaaggttattcaatgggctattttgct
ggaatgctagcgagtgagatgtctcattctaataaagtaggcatcattgccgcatttcca
tttcaacctgaagtagagggctttattgaaggggcaaattatcaaaatgaaaatataaaa
gtttttacagaatttgtttatgattggacaaatgaagagaaagctctagagcatttttac
aatatgaaagggcttgaagttgatattttttatcctgcaggagatggatttcatgtaaca
cttgtcaatgagataaaggactctgggttatatgcaataggttatgtcggcgaccatatc
gacttaggcgaatctactattctaacaagtacagttcaagatgtggagcgtttatatgag
catgtagctaatgagtaccaaaatggcacattagagaatggtaatatatactacgatttt
gaagaaggcgttatttcattaggtacatttagtacagaggtgcctgatgaaataagagaa
aaaattgaagtagcgattgcccattacattgaaactggtcaattaccacatgaaatgaat
gaataa

DBGET integrated database retrieval system