Baudoinia panamericana: BAUCODRAFT_31446 Help Entry BAUCODRAFT_31446  CDS       T03106                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism bcom  Baudoinia panamericana Pathway bcom04145   Phagocytosis bcom04517   IgSF CAM signaling bcom04814   Motor proteins Brite KEGG Orthology (KO) [BR:bcom00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     BAUCODRAFT_31446  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     BAUCODRAFT_31446   09142 Cell motility    04814 Motor proteins     BAUCODRAFT_31446  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bcom03037]     BAUCODRAFT_31446    04812 Cytoskeleton proteins [BR:bcom04812]     BAUCODRAFT_31446 Cilium and associated proteins [BR:bcom03037]  Motile cilia and associated proteins   Dynein arm    BAUCODRAFT_31446 Cytoskeleton proteins [BR:bcom04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      BAUCODRAFT_31446 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  19111476 NCBI-ProteinID:  XP_007673571 JGI:  Bauco1_31446 UniProt:  M2NJ43 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MSEDMQQEAVEVAQEAMDKYNIEKEIAHHIKKEFDARKGATWHCIVGRNFGSFVTHETKH FIYFYLGHCAILLFKTQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgaagacatgcaacaagaagccgtcgaagtcgcgcaggaagccatggacaagtac aacatcgagaaggaaatcgcacaccacatcaagaaggagttcgacgcacgaaagggcgcg acatggcattgtattgtgggaaggaatttcggtagttttgtcacgcatgagaccaagcat ttcatatacttctacctcggtcattgtgcgatattgctattcaagacgcaatga

DBGET integrated database retrieval system