Baudoinia panamericana: BAUCODRAFT_66434 Help Entry BAUCODRAFT_66434  CDS       T03106                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism bcom  Baudoinia panamericana Pathway bcom03060   Protein export bcom04141   Protein processing in endoplasmic reticulum bcom04145   Phagosome Brite KEGG Orthology (KO) [BR:bcom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     BAUCODRAFT_66434    04141 Protein processing in endoplasmic reticulum     BAUCODRAFT_66434  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     BAUCODRAFT_66434  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bcom04131]     BAUCODRAFT_66434   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:bcom02044]     BAUCODRAFT_66434 Membrane trafficking [BR:bcom04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     BAUCODRAFT_66434 Secretion system [BR:bcom02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    BAUCODRAFT_66434 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE SAM_NCD1 Sec20 DUF357 Motif Other DBs NCBI-GeneID:  19116282 NCBI-ProteinID:  XP_007674597 JGI:  Bauco1_66434 UniProt:  M2NGB8 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MDQAKELLEMPRQFLKDGRQFITRCSKPDRREFLRISQAVGMGFLIMGVIGYVVKLIHIP VNNILVGGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaccaagcgaaggagctcctggagatgcctcgccagttcctcaaggatggcagacaa tttatcacacgatgtagcaaaccggaccgtcgagagttcttaagaataagtcaggctgtt ggaatgggcttcttaatcatgggtgtcatcggatatgtggtgaagttgattcatatcccg gttaacaacatcctagtgggcggcgcatga

DBGET integrated database retrieval system