Baudoinia panamericana: BAUCODRAFT_72850 Help Entry BAUCODRAFT_72850  CDS       T03106                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism bcom  Baudoinia panamericana Pathway bcom03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:bcom00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     BAUCODRAFT_72850  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bcom03036]     BAUCODRAFT_72850    03400 DNA repair and recombination proteins [BR:bcom03400]     BAUCODRAFT_72850 Chromosome and associated proteins [BR:bcom03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      BAUCODRAFT_72850 DNA repair and recombination proteins [BR:bcom03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      BAUCODRAFT_72850 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C DUF815 Motif Other DBs NCBI-GeneID:  19116773 NCBI-ProteinID:  XP_007677599 JGI:  Bauco1_72850 UniProt:  M2MEC3 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MPGLQTQGDTSKEERLKAALWHSVGSTVDAVCIQQDINATPHFIAGLNEMCFAQIENIAH DLEAFAKHCGRGVIGANDVVLLGRRNDGLSAVLRAEAKAVKESNDLR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgccaggtctacagacccagggggacacctccaaggaagagaggttgaaggcagccctt tggcattccgtgggctcgacggttgatgcggtgtgcattcagcaagacataaatgccact ccacacttcattgcaggcttgaacgagatgtgctttgctcagatcgagaacattgctcat gacctcgaagcatttgcgaagcattgcggccgaggagtcatcggtgcgaacgacgttgta ttgctgggcaggaggaacgacggcctcagtgcagttctacgagccgaagcgaaggcagtg aaggaaagcaacgacctacgatga

DBGET integrated database retrieval system