Burkholderia contaminans: NL30_06030 Help Entry NL30_06030        CDS       T03969                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism bcon  Burkholderia contaminans Brite KEGG Orthology (KO) [BR:bcon00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bcon03036]     NL30_06030    03400 DNA repair and recombination proteins [BR:bcon03400]     NL30_06030 Chromosome and associated proteins [BR:bcon03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     NL30_06030 DNA repair and recombination proteins [BR:bcon03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       NL30_06030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS LemA YL1_C Motif Other DBs NCBI-ProteinID:  AKM39481 UniProt:  A0A0G3YMY0 LinkDB All DBs Position 1:1398768..1399058 Genome browser AA seq 96 aa AA seqDB search MHQLQTLQAQLAELDRRIKAARSRERRAVLAQVRELVTGYALTAREIFGQGYSDRAKLFT VGAKYRDPATGATWSGRGRAPAWIVGRDRTAFLIRE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcatcaactgcagacactgcaagcccagcttgcggaactcgatcggcgcatcaaggcg gcacgcagccgcgaacgccgcgcggtgctggcgcaggtacgcgagctcgtcaccggctac gcgctgaccgcgcgggaaatcttcgggcagggttacagcgatcgcgcgaagctgtttacg gtcggggcgaagtatcgcgacccggcaaccggcgcgacatggagcggccgcggccgcgca cccgcatggatcgtcgggcgcgaccgcaccgcgttcctgatccgggagtaa

DBGET integrated database retrieval system