Burkholderia contaminans: NL30_19175 Help Entry NL30_19175        CDS       T03969                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bcon  Burkholderia contaminans Brite KEGG Orthology (KO) [BR:bcon00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bcon03032]     NL30_19175    03036 Chromosome and associated proteins [BR:bcon03036]     NL30_19175    03400 DNA repair and recombination proteins [BR:bcon03400]     NL30_19175 DNA replication proteins [BR:bcon03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NL30_19175 Chromosome and associated proteins [BR:bcon03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NL30_19175 DNA repair and recombination proteins [BR:bcon03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NL30_19175 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 DUF2267 Motif Other DBs NCBI-ProteinID:  AKM42054 UniProt:  A0A0G3YVC9 LinkDB All DBs Position 2:809849..810127 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccgcccaaacgggcgccagcaaggctcaa accggcgaaacgctggacacgctgctcgaagtcatcaagaaggccgtgtcgaagggtgat gcggttcagctgatcggcttcggcagcttcggttcgggcaagcgcgcagcacgtacgggc cgcaacccgaagacgggcgaaaccatcaagatcccggcagccaagacggtcaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagcgttaa

DBGET integrated database retrieval system