Burkholderia contaminans: NL30_26885 Help Entry NL30_26885        CDS       T03969                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bcon  Burkholderia contaminans Pathway bcon00998   Biosynthesis of various antibiotics bcon01100   Metabolic pathways bcon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bcon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NL30_26885    00074 Mycolic acid biosynthesis     NL30_26885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NL30_26885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKM43420 UniProt:  A0A0G3Z130 LinkDB All DBs Position 2:complement(2508766..2509026) Genome browser AA seq 86 aa AA seqDB search MNALEQELATLIIGELNLEDVTLETVTAETPLYGEGFGLDSIDILEIALLISKKYGFELR SDNPDNQKIFATLGALAAYVAAHRTK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgcactggaacaagagctcgccacgctgatcatcggcgaactgaatctcgaagac gtcacgctcgaaaccgtgacggccgagaccccgttgtatggcgagggtttcgggctcgac tccatcgacatcctggaaatcgccctgctgatctcgaagaaatacggcttcgagttgcgt tcggataatccggacaaccagaagatctttgcgacgctcggtgcactggctgcgtacgtc gccgcgcaccgcacgaagtga

DBGET integrated database retrieval system