Bradysia coprophila: 119066479 Help Entry 119066479         CDS       T08269                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bcoo  Bradysia coprophila Pathway bcoo04013   MAPK signaling pathway - fly bcoo04145   Phagosome bcoo04148   Efferocytosis bcoo04310   Wnt signaling pathway bcoo04620   Toll-like receptor signaling pathway bcoo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     119066479    04310 Wnt signaling pathway     119066479  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119066479    04148 Efferocytosis     119066479  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     119066479  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     119066479  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bcoo04131]     119066479   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bcoo04147]     119066479    04031 GTP-binding proteins [BR:bcoo04031]     119066479 Membrane trafficking [BR:bcoo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     119066479  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     119066479   Macropinocytosis    Ras GTPases     119066479  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     119066479 Exosome [BR:bcoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119066479   Exosomal proteins of other body fluids (saliva and urine)    119066479   Exosomal proteins of colorectal cancer cells    119066479   Exosomal proteins of bladder cancer cells    119066479 GTP-binding proteins [BR:bcoo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     119066479 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  119066479 NCBI-ProteinID:  XP_037024879 LinkDB All DBs Position IV:complement(2787373..2789791) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPNTPIILVGTKLDLR DDKSTIEKLRDKKLAPVTYPQGLAMAKEIYSVKYLECSALTQKGLKTVFDEAIRAVLCPV ITTKPKRKCTLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcaatcaagtgtgtggtggtcggcgacggagctgttggtaaaacatgtcttctc atcagttatacaacaaatgcctttccgggtgaatacatacccacagtattcgacaattat tcggccaatgttatggttgacggtaaaccgatcaatctgggcctatgggatacagccggc caggaggattacgacagattgcgaccgttgtcctatccacagaccgatgtctttttgatt tgtttttcgctggtcaatccggcatcattcgaaaatgtgcgggccaaatggttcccggag gtgcgccatcactgtccgaatacaccgatcattttagtgggcacaaaattggatttgcga gatgataagagcacaatagagaaattacgcgataaaaaactggcaccggtcacgtatccg caaggtttggccatggccaaagaaatctattccgtcaaatatttggaatgttcggcattg acacagaagggattaaaaacggttttcgatgaagctatacgggctgtattgtgtccggtg attacgacaaaaccgaaacgcaagtgtacgttactataa

DBGET integrated database retrieval system