Bradysia coprophila: 119068888
Help
Entry
119068888 CDS
T08269
Name
(RefSeq) S-phase kinase-associated protein 1-like
KO
K03094
S-phase kinase-associated protein 1
Organism
bcoo
Bradysia coprophila
Pathway
bcoo03083
Polycomb repressive complex
bcoo04120
Ubiquitin mediated proteolysis
bcoo04141
Protein processing in endoplasmic reticulum
bcoo04310
Wnt signaling pathway
bcoo04341
Hedgehog signaling pathway - fly
bcoo04350
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:
bcoo00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
119068888
04120 Ubiquitin mediated proteolysis
119068888
09126 Chromosome
03083 Polycomb repressive complex
119068888
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
119068888
04341 Hedgehog signaling pathway - fly
119068888
04350 TGF-beta signaling pathway
119068888
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
bcoo04131
]
119068888
04121 Ubiquitin system [BR:
bcoo04121
]
119068888
03036 Chromosome and associated proteins [BR:
bcoo03036
]
119068888
Membrane trafficking [BR:
bcoo04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
119068888
Ubiquitin system [BR:
bcoo04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
119068888
Cul7 complex
119068888
Chromosome and associated proteins [BR:
bcoo03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
119068888
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
119068888
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
BTB
CfAFP
Motif
Other DBs
NCBI-GeneID:
119068888
NCBI-ProteinID:
XP_037028650
LinkDB
All DBs
Position
X
Genome browser
AA seq
162 aa
AA seq
DB search
MPTIRLQSSDGEVFDTDEQIAKCSGTIKTMLEDCGMDEGEDAVVPLPNVNSAILRKVLQW
ANYHKDDPVPQEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDTKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFSAAEEEQVRKENEWCEEK
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgcctaccatccgtttacaatcctccgatggcgaagttttcgacacagacgagcagata
gcaaagtgctcaggcacgatcaagaccatgctcgaagattgtggcatggatgagggcgaa
gacgcagttgtaccgttgccgaacgtgaattcagcaattttgcgaaaagttttgcaatgg
gcaaactatcacaaagacgatccagtaccgcaagaagatgacgaaaataaggaaaaacga
accgatgacatttcgtcgtgggatgcagacttcctgaaagtggaccagggcacactgttc
gaattgattttggcagcgaattacttggacacaaagggactgttggacgttacttgcaaa
actgttgctaacatgatcaagggcaagacaccagaagagatccgtaagacgttcaacatt
aagaacgatttttcggcagctgaagaggaacaggttcgtaaagagaacgaatggtgcgag
gagaagtaa
DBGET
integrated database retrieval system