Bradysia coprophila: 119080381 Help Entry 119080381         CDS       T08269                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism bcoo  Bradysia coprophila Pathway bcoo04814   Motor proteins Brite KEGG Orthology (KO) [BR:bcoo00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     119080381  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bcoo03037]     119080381    04812 Cytoskeleton proteins [BR:bcoo04812]     119080381 Cilium and associated proteins [BR:bcoo03037]  Motile cilia and associated proteins   Dynein arm    119080381 Cytoskeleton proteins [BR:bcoo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      119080381 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light YcxB Motif Other DBs NCBI-GeneID:  119080381 NCBI-ProteinID:  XP_037044583 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MADESSAKENEGDKKIVHTYPLVKHSDMIEEMKTDCIELSITACEKFAANYEMAAKTIKD AMDKKFGTFWHVIVGEGFGFEVSYETKNLLYLFFGGNLAVVIWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctgatgagagttcagcgaaggaaaatgaaggcgataagaaaattgtacatacgtac cctttggtgaagcactcagacatgatcgaagaaatgaagactgactgcattgagctgagt ataacggcatgcgaaaaatttgcagccaactatgaaatggctgcaaaaacgattaaagat gcaatggacaaaaaattcggaacattttggcatgtcatagttggtgaaggattcggattc gaagtgtcttatgagacgaaaaaccttctgtatttgttttttggtggcaatttggccgtt gtaatatggaaatgttcttaa

DBGET integrated database retrieval system